Skip to Content

ELISA Recombinant Arabidopsis thaliana Ubiquitin carboxyl-terminal hydrolase 27(UBP27)

https://assay.labm.com/web/image/product.template/117225/image_1920?unique=7f7b80c
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q9FPS0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSRRGSETKAIVCVLTDRIRISNQWVSHLSFAGLLGVAGFVFAQQHGLFRNLNNLKLFS GREKDSGDDSFLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQ LPLTFALSALLQELGTVGSRRSVSNPRKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQ EEIVVCYRPSQSSNLSDILFSRNLRmLAPSEGLHGLMELKRWHKHLRGPFDGILGSTLMC RTCSSQISLEFQFFHTLPLSPLLHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHG AALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARFPKL LCIQVQRASFNMFEEFKLSGHIAFPLVLNLSLFTPSSIGVNIEERIEMSSEYQKPEASKN HGMYRLVTVVEHFGRTGSGHYTVYRSVRVFSQEEEEEDCDEDLSWFSISDSEVCRVSESD VLGAEASLLFYERL Protein Names:Recommended name: Ubiquitin carboxyl-terminal hydrolase 27 EC= 3.4.19.12 Alternative name(s): Deubiquitinating enzyme 27 Short name= AtUBP27 Ubiquitin thioesterase 27 Ubiquitin-specific-processing protease 27 Gene Names:Name:UBP27 Ordered Locus Names:At4g39370 ORF Names:F23K16.5 Expression Region:1-494 Sequence Info:fµLl length protein

1,856.00 € 1856.0 EUR 1,856.00 € Tax Excluded

1,856.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF880815DOA
Website URL: /shop/csb-cf880815doa-elisa-recombinant-arabidopsis-thaliana-ubiquitin-carboxyl-terminal-hydrolase-27-ubp27-117225

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.