ELISA Recombinant Vibrio harveyi Na(+)-translocating NADH-quinone reductase subunit D(nqrD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120) Uniprot NO.:Q9RFV8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSAQNIKKSIMAPVLDNNPIALQVLGVCSALAVTTKLETAFVMTLAVTFVTALSNFSVS LIRNHIPNSVRIIVQMAIIASLVIVVDQVLKAYLYDISKQLSVFVGLIITNCIVMGRAEA FAMKSAPVPSLIDGIGNGLGYGFVLITVGFFRELFGSGKLFGMEVLPLVSNGGWYQPNGL mLLAPSAFFLIGFLIWVIRILKPEQVEAKE Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit D Short name= Na(+)-NQR subunit D Short name= Na(+)-translocating NQR subunit D EC= 1.6.5.- Alternative name(s): NQR complex subunit D NQR-1 subunit D Gene Names:Name:nqrD Ordered Locus Names:VIBHAR_03272 Expression Region:1-210 Sequence Info:fµLl length protein