ELISA Recombinant Mouse Probable palmitoyltransferase ZDHHC12(Zdhhc12)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q8VC90 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MALWPPLNSGmLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLSSLLL YLAVSLMDPGYVTTQPQPQGEPKEEQAAMVPQAVPLRRCRHCLVLQPLRARHCRDCRRCV RRYDHHCPWMENCVGERNHPLFVAYLALQLVVLLWGLCLAWSGLQFFQPWGLWLRSTGLL FTTFLLLSFFALVVALLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDRGPTRNLA HFFCGWPSGPWETLSAEEEEEGSSQVV Protein Names:Recommended name: Probable palmitoyltransferase ZDHHC12 EC= 2.3.1.- Alternative name(s): Zinc finger DHHC domain-containing protein 12 Short name= DHHC-12 Gene Names:Name:Zdhhc12 Expression Region:1-267 Sequence Info:fµLl length protein