ELISA Recombinant Rickettsia conorii Putative Na(+)-H(+) antiporter nhaA homolog(nhaA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7) Uniprot NO.:Q92FX2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVESGIHDTLCRAIIALFIPVNIKGEFNTSFKKLENLTRPFVNYFILPLFVFMNSGILLE YFAFKGICSNSILALIYGIIFGLFVGKQLGImLFSYPFVKFKLCNLPSDTSWLKFYSIAI LGGIGFTLSLFIGSILRLRAAALQTL Protein Names:Recommended name: Putative Na(+)/H(+) antiporter nhaA homolog Gene Names:Name:nhaA Ordered Locus Names:RC1355 Expression Region:1-146 Sequence Info:fµLl length protein