ELISA Recombinant Oryza sativa subsp. japonica Two pore potassium channel b(TPKB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryza sativa subsp. japonica (Rice) Uniprot NO.:Q8LIN5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAALDQQPLLHDGGDQKPPPEGAARRFRRCRTAPSSEPPPTDKDNSSAADAPPKTLFTGG GRPSFRLVGLLLVAYLLLGTIAFYLAMDHMSGTRTTRALDALYFCVVTMTTVGYGDLVPA SDAAKLLACAFVFAGVAVVGTFLSKAADYLVEKQEALLFRALHSHTMVRAMEMNKVRYKL YTAGLLLVAAVASGTVVLWKVEGMRAVDAFYCVCATVTTLGYGDRSFSSEGGRAFAVAWI TVSTVVVALFFLYAAELYTERRQRELARWVLRRRTTNMDLEAADLDGDHRVGAADFVLYK LKELGKISQEDISEFLDEFDNLDADHSGTLSPADLAAAQPTPDPPPSLR Protein Names:Recommended name: Two pore potassium channel b Short name= Two K(+) channel b Alternative name(s): Calcium-activated outward-rectifying potassium channel 2 Short name= OsKCO2 Gene Names:Name:TPKB Synonyms:KCO2 Ordered Locus Names:Os07g0108800, LOC_Os07g01810 ORF Names:OJ1567_G09.108, OsJ_22819, P0585H11.123 Expression Region:1-349 Sequence Info:fµLl length protein