ELISA Recombinant Pseudomonas stutzeri Cbb3-type cytochrome c oxidase subunit CcoP2(ccoP2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas stutzeri (Pseudomonas perfectomarina) Uniprot NO.:Q8KS19 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSFWSWYVTLLSLGTIAALVWLLLATRKGQRPDSTEETVGHSYDGIEEYDNPLPRWWFM LFVGTVIFALGYLVLYPGLGNWKGILPGYEGGWTQVKEWQREMDKANEQYGPLYAKYAAM PVEEVAKDPQALKMGGRLFASNCSVCHGSDAKGAYGFPNLTDDDWLWGGEPETIKTTILH GRQAVMPGWKDVIGEEGIRNVAGYVRSLSGRDTPEGISVDIEQGQKIFAANCVVCHGPEA KGVTAMGAPNLTDNVWLYGSSFAQIQQTLRYGRNGRMPAQEAILGNDKVHLLAAYVYSLS QQPEQ Protein Names:Recommended name: Cbb3-type cytochrome c oxidase subunit CcoP2 Short name= Cbb3-Cox subunit CcoP2 Alternative name(s): C-type cytochrome CcoP2 Short name= Cyt c(P2) Cytochrome c oxidase subunit III Gene Names:Name:ccoP2 Expression Region:1-305 Sequence Info:fµLl length protein