ELISA Recombinant Rat Cytochrome b-c1 complex subunit 8(Uqcrq)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q7TQ16 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGREFGNLTRIRHVISYSLSPFEQRAFPHYFSKGIPNVLRRTRERILRVAPPFVLFYLIY TWGNQEFAQSKRKNPAKYENDK Protein Names:Recommended name: Cytochrome b-c1 complex subunit 8 Alternative name(s): Complex III subunit 8 Complex III subunit VIII Low molecµLar mass ubiquinone-binding protein Ubiquinol-cytochrome c reductase complex 9.5 kDa protein Ubiquino Gene Names:Name:Uqcrq Synonyms:Qpc Expression Region:1-82 Sequence Info:fµLl length protein