ELISA Recombinant Mouse Progestin and adipoQ receptor family member 3(Paqr3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:Q6TCG8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHQKLLKSAHYIELGSYQYWPVLVPRGIRLYTYEQIPVSLKDNPYITDGYRAYLPSRLCI KSLFILSNETVNIWSHLLGFFLFFTLGIYDMTSVLPSASASREDFVICSICLFCFQVCmL CSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITVLA MILAVFFAQIHPSYLTQQWQRLRPIIFCSVSGYGVIPTLHWVWLNGGVSAPIVQDFAPRV IVMYVIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHVLAVVmLYWWHQSTVYVMQYRH SKPCPDYVSHL Protein Names:Recommended name: Progestin and adipoQ receptor family member 3 Alternative name(s): Progestin and adipoQ receptor family member III Raf kinase trapping to Golgi Short name= RKTG Gene Names:Name:Paqr3 Expression Region:1-311 Sequence Info:fµLl length protein