ELISA Recombinant Gloeobacter violaceus Photosystem II reaction center protein H(psbH)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Gloeobacter violaceus (strain PCC 7421) Uniprot NO.:Q7NCH7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MARRTWLGDRLKPLNSEIGKASPGWGTTPIMGALIALFGVFLIIILQIANNSLLLEGVNE GVPQSPAGQGYGYYPQSR Protein Names:Recommended name: Photosystem II reaction center protein H Short name= PSII-H Gene Names:Name:psbH Ordered Locus Names:gsr3002 Expression Region:1-78 Sequence Info:fµLl length protein