ELISA Recombinant Oryza nivara ATP synthase subunit b, chloroplastic(atpF)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Oryza nivara (Indian wild rice) Uniprot NO.:Q6ENH8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNVTHSFVFLAHWPSAGSFGLNTDILATNLINLTVVVGVLIYFGKGVLKDLLDNRKQRI LSTIRNSEELRRGTIEQLEKARIRLQKVELEADEYRMNGYSEIEREKANLINATSISLEQ LEKSKNETLYFEKQRAMNQVRQRVFQQAVQGALGTLNSCLNTELHFRTIRANISILGAME WKS Protein Names:Recommended name: ATP synthase subunit b, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b ATPase subunit I Gene Names:Name:atpF Expression Region:1-183 Sequence Info:fµLl length protein