ELISA Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 5(TAS2R5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gorilla gorilla gorilla (Lowland gorilla) Uniprot NO.:Q645Z1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLSAGLGLLmLVAVVEFLIGLIGNGVLVVWSFREWMRKFNWSSYNLIILGLAGCRFLLQW LIILDLSLFPLFQSSRWLRYLSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQ RAYNLSLWCLLGYFIINLLLTVQIGLMFYHPPQGNSSIRYPFESWQYLYAFRLNSGSYLP LMVFLVSSGmLIVSLYTHHKKMKVHSAGRRDVRAKAHITALKSLGCFLFLHLVYIMASPF SITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVKQTCQKILWKTVCARRCWGP Protein Names:Recommended name: Taste receptor type 2 member 5 Short name= T2R5 Gene Names:Name:TAS2R5 Expression Region:1-299 Sequence Info:fµLl length protein