Skip to Content

ELISA Recombinant Protein odr-4 homolog(ODR4)

https://assay.labm.com/web/image/product.template/137678/image_1920?unique=f2aba11
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q5SWX8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHP KAKLDNLDEEWATEHACQVSRmLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSIN RKRLWNFTEEEVSERVTLHICASTKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSLE CTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKS SRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKD AVQAVKRDILNTVADRCEmLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVmLCDY KFDDESAEEIRDHFMEmLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI KTTmLLKIQQNIGVIAAFTVAVLAAGISFHYFSD Protein Names:Recommended name: Protein odr-4 homolog Short name= hODR-4 Alternative name(s): LAG1-interacting protein Transactivated by transforming growth factor beta protein 1 Gene Names:Name:ODR4 Synonyms:C1orf27, TTG1, TTG1A Expression Region:1-454 Sequence Info:fµLl length protein

1,814.00 € 1814.0 EUR 1,814.00 € Tax Excluded

1,814.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF725554HU
Website URL: /shop/csb-cf725554hu-elisa-recombinant-protein-odr-4-homolog-odr4-137678

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.