Skip to Content

ELISA Recombinant Candida albicans Chitin synthase export chaperone(CHS7)

https://assay.labm.com/web/image/product.template/121344/image_1920?unique=7485b17
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast) Uniprot NO.:Q5AA40 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFGSFDHICNKTALPLCSVVGAVNQSAFFQRGIVPDCYARSVELANTMIFQIGNAFVHF GGLIILLIIIFNVRAKYTAIGRKEmLFFLYLAIGLIVSSLIVDCGVSPPSSTSYAYFVAV QIGLSSALCICLLYNGFLCFQFWEDGTSRSMWILRVGCFAWFAVNFIVCIITFKHWDTAL DYRKTTTLFIFAYVLNAVILAVYVVSQIILVVFALESYWSLGAILLGVFFFVAGQVLTYV FSDKICRGASHYVDGLFFGSACNVFTFMMIYKFWDMITSDDLEFSVANVEQPINEFGVGA DDEKRSSMFF Protein Names:Recommended name: Chitin synthase export chaperone Gene Names:Name:CHS7 ORF Names:CaO19.2444, CaO19.9980 Expression Region:1-310 Sequence Info:fµLl length protein

1,662.00 € 1662.0 EUR 1,662.00 € Tax Excluded

1,662.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF685482CZD
Website URL: /shop/csb-cf685482czd-elisa-recombinant-candida-albicans-chitin-synthase-export-chaperone-chs7-121344

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.