ELISA Recombinant Staphylococcus haemolyticus Heme A synthase(ctaA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Staphylococcus haemolyticus (strain JCSC1435) Uniprot NO.:Q4L5C9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFNKRNLKWLSVLATIIMAFVQLGGALVTKTGSEDGCGSSWPLCHGALLPQNLPIDTIIE LSHRAVSGLSLIVVLWLAITAWKHIGYIREVKPLAIISIAFLLVQALIGAAAVIWQQNSY VLALHFGISLISFSSVFVLmLIIFEVDKKYEADELYIRKPLRRLTWIMTGIVYLTIYTGA LVRHAKASLAYGGWPLPFHDIIPHTEQDWVQFAHRGMAFITFFWIMITFIHAVKNYSENR TIRYGYTTAFILIILQVITGALSVMTNVNLFIALLHALFITILFGMIAYFImLmLRTIRS EKIK Protein Names:Recommended name: Heme A synthase Short name= HAS EC= 1.3.-.- Alternative name(s): Cytochrome aa3-controlling protein Gene Names:Name:ctaA Ordered Locus Names:SH1837 Expression Region:1-304 Sequence Info:fµLl length protein