ELISA Recombinant Staphylococcus saprophyticus subsp. saprophyticus Heme A synthase(ctaA)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)
Uniprot NO.:Q49WP0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFSKKNLKWLSVLATVIMAFVQLGGALVTKTGSADGCGSDWPLCHGAFLPQNLPIQTLIE LSHRAVSGLSLIVVLWLVIVAWKHIGYIKEVKPLSCISVGFLLIQALVGAAAVMWQQNAY VLALHFGISLISFSSVFVLTLIIYEVDRKYEADELFIRKPLRIYTWIMALIVYMTIYTGA LVRHKEASLAYGQWPLPFNDLMPHNVQDWVNLTHRGMALIAFIWILITFIHAVNNYRENR TIRYGYTAAFILVILQVTTGALSIITEVNLFIALLHALFITLLFGLIAYFIILmLRTIRS GG
Protein Names:Recommended name: Heme A synthase Short name= HAS EC= 1.3.-.- Alternative name(s): Cytochrome aa3-controlling protein
Gene Names:Name:ctaA Ordered Locus Names:SSP1674
Expression Region:1-302
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF671019SBAG
Website URL:
/shop/csb-cf671019sbag-elisa-recombinant-staphylococcus-saprophyticus-subsp-saprophyticus-heme-a-synthase-ctaa-158847
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.