ELISA Recombinant Nitrosomonas eutropha Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Nitrosomonas eutropha (strain C91) Uniprot NO.:Q0AIQ0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLTKTSRPTTPQPGLISTWLLRPLLLLLAIALLYQSWFLLHIIYWRTYHPTTSAFMQDR LETMHRQNPAAKLQHRWVDYEQISNHLKRAVIATEDARFMQHQGFDYKAIEVAWKKNLKQ RKLAAGGSTISQQLAKNLFLSSEKTVWRKLQETLITLILEEFLSKRRILEIYLNVIEWGE GVFGIEAAARHYFGIPASSLAPEQSAWLASIISNPRFYDTHRQSPRLLKKARIILSRLPT AKIP Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.- Gene Names:Name:mtgA Ordered Locus Names:Neut_0495 Expression Region:1-244 Sequence Info:fµLl length protein