ELISA Recombinant Laccaria bicolor Solute carrier family 25 member 38 homolog (LACBIDRAFT_191230)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) (Bicoloured deceiver) (Laccaria laccata var. bicolor) Uniprot NO.:B0DK57 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNVGQQLLSGGLSGLATTVCLQPFDLLKTRLQQGDGSTWRPTRPHTSIILDITRDVIHS GGWRGLWRGTTPSLVRNVPGVALYMTSLTQLRALMATSPYFASLRRRPQNGDANKNTSSV LPKLTSQGNLIAGATTRVGVGFLLNPFSVLKARFESNIYAYESLTGAFGTIVRQGPSELL RGFLASSLRDAPYAGLFVVFYEGIKHEASYVLPPVTSTQATLIHGLSAASAGAIATMATH PFDVIKTKIQVRTEAQYHGFLTTIATIWKQRGITGYFDGASLRMSRKVLSSAIGWAVYEG GLmLMRTST Protein Names:Recommended name: Solute carrier family 25 member 38 homolog Gene Names:ORF Names:LACBIDRAFT_191230 Expression Region:1-309 Sequence Info:fµLl length protein