Skip to Content

ELISA Recombinant Southern bean mosaic virus Replicase polyprotein P2AB (ORF2A-2B)

https://assay.labm.com/web/image/product.template/157693/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Southern bean mosaic virus (isolate Bean/United States/Arkansas) (SBMV) Uniprot NO.:O72157 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TVAEPLNLPAGGRVKALAALSQLAGYDFKEGEAASTRGMPLRFVGQSACKFRELCRKDTP DEVLRATRVFPELSDFSWPERGSKAELHSLLLQAGKFNPTGIPRNLEGACQNLLERYPAS KSCYCLRGEAWSFDAVYEEVCKKAQSAEINEKASPGVPLSRLASTNKDLLKRHLELVALC VTERLFLLSEAEDLLDESPVDLVRRGLCDPVRLFVKQEPHASRKVREGRFRLISSVSLVD QLVERmLFGPQNQLEIAEWEHIPSKPGMGLSLRQQAKSLFDDLRVKHSRCPAAEADISGF DWSVQDWELWADVEMRIVLGGFGHKLAKAAQNRFSCFMNSVFQLSDGTLIEQQLPGIMKS GSYCTSSTNSRIRCLMAELIGSPWCIAMGDDSVEGWVDGAKDKYMRLGHTCKDYKPCATT ISGRLYEVEFCSHVIREDRCWLASWPKTLFKYLSEGKWFFEDLERDVSSSPHWPRIRHYV VGNTPSPHKTNLQNQSPRYGEEVDKTTVNQGYSEHSGSPGHSIEEAQEPEAAPFCCEAAS VYPGWGVHGPYCSGDYGSLT Protein Names:Recommended name: Replicase polyprotein P2AB Cleaved into the following 4 chains: 1. N-terminal protein 2. Serine protease EC= 3. 3.4.21.- 4. VPg 5. RNA-directed RNA polymerase EC= 6. 2.7.7.48 Alternative name(s): RdR Gene Names:ORF Names:ORF2A-2B Expression Region:403-962 Sequence Info:fµLl length protein

1,926.00 € 1926.0 EUR 1,926.00 € Tax Excluded

1,926.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF529146FJT
Website URL: /shop/csb-cf529146fjt-elisa-recombinant-southern-bean-mosaic-virus-replicase-polyprotein-p2ab-orf2a-2b-157693

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.