ELISA Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_518 (MTH_518)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)
Uniprot NO.:O26618
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVCMRFRYICHRKPERTFSFRGHYFPVCSRCTGIYLGAFTYFLYAFLIPVKYTAATVLLA LLLVIPTFIDGFTQLMGYRESNNVLRFSTGLPAGIGLAVLTKVLKHLILHI
Protein Names:Recommended name: Uncharacterized protein MTH_518
Gene Names:Ordered Locus Names:MTH_518
Expression Region:1-111
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF521400MSR
Website URL:
/shop/csb-cf521400msr-elisa-recombinant-methanothermobacter-thermautotrophicus-uncharacterized-protein-mth-518-mth-518-143283
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.