ELISA Recombinant Bacillus subtilis Putative transport permease yvfS(yvfS)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:O07017 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNVLQKQSIAEMKRVLRNKYFVLWSLIMPIAFYYFFTNVVNTNVPDQRAWEAHYLMSMTV FSVMGSSIMTLGIRMVQERSQGWAAFIRLTPLPDHIYLSAQMIGQSVIHVLSITVIFLFG AIINDIALSPFEWMMSGLWILFGALPFLALGTLIGLMRKVETAAGISNVLYmLLALGGGM WMPFEVMPDMMQSIGQWLPSYHFGSGAWELVRGGSPTWKNILILIAYMmLFmLLSKYIRR KQEAV Protein Names:Recommended name: Putative transport permease yvfS Gene Names:Name:yvfS Ordered Locus Names:BSU34080 Expression Region:1-245 Sequence Info:fµLl length protein