ELISA Recombinant Helicobacter pylori Cbb3-type cytochrome c oxidase subunit CcoP(ccoP)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Helicobacter pylori (strain 52) Uniprot NO.:D0K261 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDFLNDHINVFGLIAALVILVLTIYESSSLIKEMRDSKSQGELMENGHLIDGIGEFANNV PVGWIASFMCTIVWAFWYFFFGYPLNSFSQIGQYNEEVKAHNQKFEAKWKNLGQKELVDM GQGIFLVHCSQCHGITAEGLHGSAQNLVRWGKEEGIMDTIKHGSKGMDYLAGEMPAMELD EKDAKAIASYVMAEISSVKKTKNPQLIDKGKELFESMGCTGCHGNDGKGLQENQVFAADL TAYGTENFLRNILTHGKKGNIGHMPSFKYKNFSDLQVKALAEFIQSLKPLED Protein Names:Recommended name: Cbb3-type cytochrome c oxidase subunit CcoP Short name= Cbb3-Cox subunit CcoP Alternative name(s): C-type cytochrome CcoP Short name= Cyt c(P) Cytochrome c oxidase subunit III Gene Names:Name:ccoP Ordered Locus Names:HPKB_0155 Expression Region:1-292 Sequence Info:fµLl length protein