ELISA Recombinant Ricinus communis CASP-like protein RCOM_0936380 (RCOM_0936380)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ricinus communis (Castor bean) Uniprot NO.:B9RZ92 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVELKKVFSTILRFLALAATVVAVIVMIRSHDSAIVLNLTFSAKYNNTPAFKYFVIAEG IASVYTIIVIFLWSKGLLGRLIVILDMVTTVLLTSSISAALAIAQVGKKGNSHAGWLPVC GQVPKFCDQAIIALVAGFVAAIVYFmLLLCSLHAVLTPIFAVKP Protein Names:Recommended name: CASP-like protein RCOM_0936380 Gene Names:ORF Names:RCOM_0936380 Expression Region:1-164 Sequence Info:fµLl length protein