ELISA Recombinant Cyanothece sp. Apocytochrome f(petA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1)) Uniprot NO.:B7JYG7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YPFWAQQTAPETPREATGRIVCANCHLAQKPAEVEIPQSVLPDTVFEAVVKIPYDLDSQQ VLGDGSKGGLNVGAVLmLPEGFKIAPEDRIPEEMKEKIEGLYFQPYREDQENVVIVGPLP GDQYQEIVFPVLSPDPATNKSIEFGKYSVHLGANRGRGQVYPTGELSNNNAFKASKAGTV TEISQTEEGGYSVTVTTSEGDVVETIPPGPELIVTKGQQVAAGDALTNNPNVGGFGQKDT EVVLQSPGRIKGLMVFLAGImLAQILLVIKKKQVERVQAAEMNF Protein Names:Recommended name: Apocytochrome f Gene Names:Name:petA Ordered Locus Names:PCC8801_0754 Expression Region:45-328 Sequence Info:fµLl length protein