ELISA Recombinant Drosophila yakuba Calcium channel flower(flower)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Drosophila yakuba (Fruit fly) Uniprot NO.:B4PD01 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVS CLVAGIIQMVAGFVVmLLEAPCCFVCFEQVNVIADKVDSKPLYFRAGLYITMAIPPIILC FGLASLFGSGLIFGTGVVYGMMALGKKASAEDMRAAAQQTFGGNTPAQTNDRAGIVNNAQ PFSFTGAVGTDSNV Protein Names:Recommended name: Calcium channel flower Gene Names:Name:flower ORF Names:GE19812 Expression Region:1-194 Sequence Info:fµLl length protein