Skip to Content

ELISA Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsB(ccsB)

https://assay.labm.com/web/image/product.template/159432/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechococcus sp. (strain RCC307) Uniprot NO.:A5GV87 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKSLVLKAAAWLSDLRVAIVLLLLIAACSGLGTAIPQGEPAAFYHERYDAAPWLGVVNGN QLLSWELDHLYTSNWFLLLLAWLGLALLLCSLRRQWPALRASLRWLDYTKPRQLSKLAVA TSLDTGDSAAALDQLERQLQQQGWAVRRQQNRLAARRGVIGRVGPLLVHTGLIVFMVGAV VGAFGGQRLERFLAPGRSLELLNPQGDTRLELQLDSFAIQRDPAGRPEQFSSQLLLRDGT GAPAQPAAVSVNHPLRHRGITVYQADWGLAAVTMQLGQSPLLQLPLQTFPELGEQVWGLV LPTRPDGSDPVLLALQSELGPVEVYGADSQQLGLLTVGGESQEILGLPLRIADVMPASGL LIKRDPGVPLVYAGFAITLLGGGLSLIATRQLWAISESGRLHIAGLCNRNLVAFADELPK LGSSAITGAPHDAR Protein Names:Recommended name: Cytochrome c biogenesis protein CcsB Gene Names:Name:ccsB Synonyms:ccs1 Ordered Locus Names:SynRCC307_1893 Expression Region:1-434 Sequence Info:fµLl length protein

1,793.00 € 1793.0 EUR 1,793.00 € Tax Excluded

1,793.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF401227SVB
Website URL: /shop/csb-cf401227svb-elisa-recombinant-synechococcus-sp-cytochrome-c-biogenesis-protein-ccsb-ccsb-159432

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.