ELISA Recombinant Quaternary ammonium compound-resistance protein qacE(qacE)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli
Uniprot NO.:P0AGC9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKGWLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLKSIPVGVAY AVWSGLGVVIITAIAWLLHGQKLDAWGFVGMGLIVSGVVVLNLLSKASAH
Protein Names:Recommended name: Quaternary ammonium compound-resistance protein qacE Alternative name(s): Quaternary ammonium determinant E
Gene Names:Name:qacE
Expression Region:1-110
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF366192ENL
Website URL:
/shop/csb-cf366192enl-elisa-recombinant-quaternary-ammonium-compound-resistance-protein-qace-qace-114237
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.