ELISA Recombinant Uncharacterized protein Mb0486 (Mb0486)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mycobacterium bovis Uniprot NO.:P64696 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ALQRPDAYTAADKLTKPVWLVILGAAVALASILYPVLGVLGMAMSACASGVYLVDVRPKL LEIQGKSR Protein Names:Recommended name: Uncharacterized protein Mb0486 Gene Names:Ordered Locus Names:Mb0486 Expression Region:20-87 Sequence Info:fµLl length protein