Skip to Content

ELISA Recombinant Mouse L-gulonolactone oxidase(Gulo)

https://assay.labm.com/web/image/product.template/143547/image_1920?unique=2109108
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:P58710 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VHGYKGVQFQNWAKTYGCSPEMYYQPTSVGEVREVLALARQQNKKVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLQVDKEKKQVTVEAGILLTDLHPQLDKHGLALSNLGAVSDVTVGGV IGSGTHNTGIKHGILATQVVALTLMKADGTVLECSESSNADVFQAARVHLGCLGVILTVT LQCVPQFHLLETSFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSIIYQDHTNKEPSS ASNWFWDYAIGFYLLEFLLWTSTYLPRLVGWINRFFFWLLFNCKKESSNLSHKIFSYECR FKQHVQDWAIPREKTKEALLELKAmLEAHPKVVAHYPVEVRFTRGDDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHNCTRKDFEKMYPAFHKFCDIR EKLDPTGMFLNSYLEKVFY Protein Names:Recommended name: L-gµLonolactone oxidase Short name= LGO EC= 1.1.3.8 Alternative name(s): L-gµLono-gamma-lactone oxidase Short name= GLO Gene Names:Name:GµLo Expression Region:2-440 Sequence Info:fµLl length protein

1,798.00 € 1798.0 EUR 1,798.00 € Tax Excluded

1,798.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF349177MO
Website URL: /shop/csb-cf349177mo-elisa-recombinant-mouse-l-gulonolactone-oxidase-gulo-143547

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.