ELISA Recombinant Neisseria meningitidis serogroup A - serotype 4A Capsule polysaccharide export inner-membrane protein CtrC(ctrC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) Uniprot NO.:P57012 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKELHKTSFLESLLIQKRVIGALLMREIITRYGRNNIGFLWLFVEPLLLTLVMVLMWKFF RMHNVSALNIVAFTLTGYPMMMMWRNASNHAIGSISANTSLLYHRNVRVLDTIFARmLLE IAGATIAQVVIMFALVIIGWIDVPADIFYmLLAWLLMAMFAVGLGLVICSVAFHFEPFGK VWSTISFVMMPLSGVFFFVHNLPQQLQHYVLMIPMVHGTEMFRAGYFGDSVTTYENPWYI LLCNLVLLLLGLAVVARFSKGVEPQ Protein Names:Recommended name: CapsµLe polysaccharide export inner-membrane protein CtrC Gene Names:Name:ctrC Ordered Locus Names:NMA0196 Expression Region:1-265 Sequence Info:fµLl length protein