Skip to Content

ELISA Recombinant Bacillus subtilis Rhomboid protease gluP(gluP)

https://assay.labm.com/web/image/product.template/118503/image_1920?unique=5f2a55b
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P54493 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFLLEYTYWKIAAHLVNSGYGVIQAGESDEIWLEAPDKSSHDLVRLYKHDLDFRQEMVRD IEEQAERVERVRHQLGRRRMKLLNVFFSTEAPVDDWEEIAKKTFEKGTVSVEPAIVRGTM LRDDLQAVFPSFRTEDCSEEHASFENAQMARERFLSLVLKQEEQRKTEAAVFQNGKPTFT YLFIALQILMFFLLEINGGSTNTETLVAFGAKENSLIAQGEWWRLLTPIVLHIGIAHLAF NTLALWSVGTAVERMYGSGRFLLIYLAAGITGSIASFVFSPYPSAGASGAIFGCLGALLY VALSNRKMFLRTIGTNIIVIIIINLGFGFAVSNIDNSGHIGGLIGGFFAAAALGLPKAGA FGKRLLSAVLLIALAVGFLYYGLHSPSHQESALIQQASELYQEGKYEEVTELLNGEAAQK DASADLLKILAVSDIQIGEYDQAVSLLERAVKKEPKDHASYYNLALLYAEKNELAQAEKA IQTAVKLKPKEQRYKELQRQIENNKES Protein Names:Recommended name: Rhomboid protease gluP EC= 3.4.21.105 Alternative name(s): Intramembrane serine protease Gene Names:Name:gluP Synonyms:yqgP Ordered Locus Names:BSU24870 Expression Region:1-507 Sequence Info:fµLl length protein

1,870.00 € 1870.0 EUR 1,870.00 € Tax Excluded

1,870.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF344975BRJ
Website URL: /shop/csb-cf344975brj-elisa-recombinant-bacillus-subtilis-rhomboid-protease-glup-glup-118503

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.