ELISA Recombinant Ubiquinol oxidase subunit 2(cyaB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Acetobacter aceti Uniprot NO.:P50653 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CELDVLDPKGPVGEGVKTLIATSTVAmLIVVIPTILETLLFAWQYRQSNTSAEYLPKWCH SNKIEVTIWGVPSLIILFLAVITYQTCHSLDPYKPLEAEANTKPLHVEVVALDWKWLFIY PEQGIATVNQLAIPVNTPIDFNITSDSVMNSFFIPRLGSMIYAMAGMQTQLHLLASEPGD YLGESANYSGRGFSDMKFHTLAVSGDEFNAWVEKVKSSSEQLDSQTYPKLAAPSENPVEY FAHVEPGMFNTIVAKYNNGMVMDKSTGKMIQVQQSAMSDMNMKE Protein Names:Recommended name: Ubiquinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome A1 subunit 2 Oxidase BA(3) subunit 2 Ubiquinol oxidase polypeptide II Gene Names:Name:cyaB Expression Region:24-307 Sequence Info:fµLl length protein