ELISA Recombinant Saccharomyces cerevisiae Mitochondrial organizing structure protein 2(MOS2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P50087
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTKDFYRQLDPVEEKIVPPENAIVISSEAKEATVNEKEAKQGVLSQRVMKYIGENELVDG ISVRDPDYLKRFFNERRKQFSAKWDKVTNKIDDIAGRYYAREESFTSTIASLHTDPNERL IPGLLSILVASMTGSVLARRRTWLLRATMPIILGSCCFAYAMPTTFRNTMGLIHNLEMNT FPHFTERQDRVWKETKRLSTASVQYYYDAKKWLNKDVEKTGNAIKNWTGVNVK
Protein Names:Recommended name: Mitochondrial organizing structure protein 2 Short name= MitOS2 Alternative name(s): Mitochondrial inner membrane organization component of 27 kDa
Gene Names:Name:MOS2 Synonyms:MIO27 Ordered Locus Names:YGR235C ORF Names:G8575
Expression Region:1-233
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF343459SVG
Website URL:
/shop/csb-cf343459svg-elisa-recombinant-saccharomyces-cerevisiae-mitochondrial-organizing-structure-protein-2-mos2-154408
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.