ELISA Recombinant Mycoplasma genitalium Uncharacterized protein MG267 (MG267)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) Uniprot NO.:P47509 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTLLFKLVKIAILVFLMVIGFFIFIGSFWLNTYQTAQWADLLASSDASGIILTIFPNINS WFNATVANQPVLFKTMVHFFIPVGFGLLFGLIIAIIVDILYRLTKYAIKRSYQSN Protein Names:Recommended name: Uncharacterized protein MG267 Gene Names:Ordered Locus Names:MG267 Expression Region:1-115 Sequence Info:fµLl length protein