ELISA Recombinant Saccharomyces cerevisiae Uncharacterized plasma membrane protein YNL194C (YNL194C)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P40169 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSYKKFVYFINLFFLLGATLLTFFLILAGGRTTGVLKNFYWFQASTSGFNSAPSVTRWYN YNWCGWESRGIAVNCSSKMAAQPFSPRDNFGSSPLMPSTFLNNRNAYYYLSRVGWAmLLI GLFFLLITLVSVIASLIRYNRRTAALATAMSWITLFFITLSACLYTGCYAKAVKAFHHEN RDARLGPKNFGLIWTTVFLLIVNAICCTIMVATHKRNEYIYDRSFASTKTVDSQTPTPVP TNGGIPSSVPVTEVQQSQSHQNHRFFKKLRTKKRTVTSAGDEPDRVQEERVYTEQNVPVV S Protein Names:Recommended name: Uncharacterized plasma membrane protein YNL194C Gene Names:Ordered Locus Names:YNL194C ORF Names:N1394 Expression Region:1-301 Sequence Info:fµLl length protein