Skip to Content

ELISA Recombinant Rhodobacter capsulatus Heme exporter protein C(helC)

https://assay.labm.com/web/image/product.template/153650/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) Uniprot NO.:P29961 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSIWEYANPVKFMQTSGRLLPWVVAATVLTLLPGLVWGFFFTPVAAEFGATVKVIYVHVP AATLAINIWVMmLVASLIWLIRRHHVSALAAKAAAPIGMVMTLIALITGAFWGQPMWGTW WEWDPRLTSFLILFLFYLGYMALWEAIENPDTAADLTGVLCLVGSVFAVLSRYAAIFWNQ GLHQGSTLSLDKEEHIADVYWQPLVLSIAGFGmLFVALLLLRTRTEIRARRLKALEQRER MA Protein Names:Recommended name: Heme exporter protein C Alternative name(s): Cytochrome c-type biogenesis protein HelC Gene Names:Name:helC Synonyms:ccmC Ordered Locus Names:RCAP_rcc01787 Expression Region:1-242 Sequence Info:fµLl length protein

1,590.00 € 1590.0 EUR 1,590.00 € Tax Excluded

1,590.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF328946RLD
Website URL: /shop/csb-cf328946rld-elisa-recombinant-rhodobacter-capsulatus-heme-exporter-protein-c-helc-153650

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.