Skip to Content

ELISA Recombinant Ustilago maydis Pheromone receptor 1(PRA1)

https://assay.labm.com/web/image/product.template/160382/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus) Uniprot NO.:P31302 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLDHITPFFALVAFFLVLMPFAWHIKSKNVGLImLSIWLmLGNLDNFVNSMVWWKTTADL APAYCELSVRLRHLLFIAIPASNLAIARKLESIASTRQVRAGPGDHRRAVIIDLLICLGI PIIYTSLMIVNQSNRYGILEEAGCWPMMVFSWLWVLLVAAPVIVVSLCSAVYSALAFRWF WVRRRQFQAVLASSASTINRSHYVRLLLLTAIDmLLFFPIYVGTIAAQIKSSISIPYGSW SSVHTGFNQIPQYPASLVLMENTFQRNLILARLVCPLSAYIFFAMFGLGLEVRQGYKEAF HRALLFCRLRKEPKASALQHVVADIEVVTFRSHDTFDANTSTKSEKSDIDMRGSEAA Protein Names:Recommended name: Pheromone receptor 1 Gene Names:Name:PRA1 ORF Names:UM02383 Expression Region:1-357 Sequence Info:fµLl length protein

1,712.00 € 1712.0 EUR 1,712.00 € Tax Excluded

1,712.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF327037UBS
Website URL: /shop/csb-cf327037ubs-elisa-recombinant-ustilago-maydis-pheromone-receptor-1-pra1-160382

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.