ELISA Recombinant Rhodobacter capsulatus Protein CrtK(crtK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) Uniprot NO.:P17057 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLTLFAVYFVACACAGATGAIFSPGAWYDSLKKPSWVPPNWLFPVAWSTLYILMSISAA RVSGLAMENELAVLGLAFWAVQIAVNTLWTPIFFGLHRLAGGmLVLVLLWLSVFATCVLF WSVDWLSGLMFVPYVIWVTVAGALNFSVWRLNPGEKPITL Protein Names:Recommended name: Protein CrtK Gene Names:Name:crtK Synonyms:tspO Ordered Locus Names:RCAP_rcc00681 Expression Region:1-160 Sequence Info:fµLl length protein