ELISA Recombinant Mouse Translocator protein(Tspo)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus muscµLus (Mouse)
Uniprot NO.:P50637
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM GYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVAT ATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
Protein Names:Recommended name: Translocator protein Alternative name(s): Mitochondrial benzodiazepine receptor PKBS Peripheral-type benzodiazepine receptor Short name= PBR
Gene Names:Name:Tspo Synonyms:Bzrp, Mbr
Expression Region:1-169
Sequence Info:FµLl length protein
Internal Reference:
CSB-CF025168MO
Website URL:
/shop/csb-cf025168mo-elisa-recombinant-mouse-translocator-protein-tspo-146434
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our Products !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.