ELISA Recombinant Mouse Translocator protein(Tspo)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mus muscµLus (Mouse) Uniprot NO.:P50637 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM GYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVAT ATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE Protein Names:Recommended name: Translocator protein Alternative name(s): Mitochondrial benzodiazepine receptor PKBS Peripheral-type benzodiazepine receptor Short name= PBR Gene Names:Name:Tspo Synonyms:Bzrp, Mbr Expression Region:1-169 Sequence Info:FµLl length protein