Skip to Content

ELISA Recombinant Rabbit Secretin receptor(SCTR)

https://assay.labm.com/web/image/product.template/151612/image_1920?unique=5e1ca23
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:O46502 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:HLVGAPPRLCDVLWVLQEERDQCLQELERERLGEEQPVPGCQGLWDNVSCWPSSAPGRMV ELECPRFLRmLTNSNGSLFRNCTQDGWTETFPRPDLACGVSMNDSSHERQHAYLLKLKVM YTVGYSSSLVmLLVALGILCAFRRLHCTRNYIHMHLFLSFILRALSNFIKDAVLFSSDDA IHCDAHRVGCKLVMVFFQYCIMANYAWLLVEGLYLHSLLVVSFFSERKCLQGFVVLGWGS PAMFVTSWAVTRHFLEDSGCWDINANAAIWWVIRGPVILSILINFILFINILRILTRKLR TQETRGQDMNHYKRLARSTLLLIPLFGVHYIVFVFSPEGAMEIQLFFELALGSFQGLVVA VLYCFLNGEVQLEVQKKWQQWHLWEPPLCPVALSSSFSNGTSSLNSTKACPSGRSRDTCK VSII Protein Names:Recommended name: Secretin receptor Short name= SCT-R Gene Names:Name:SCTR Expression Region:22-445 Sequence Info:FµLl length protein

1,783.00 € 1783.0 EUR 1,783.00 € Tax Excluded

1,783.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF020865RB
Website URL: /shop/csb-cf020865rb-elisa-recombinant-rabbit-secretin-receptor-sctr-151612

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.