ELISA Recombinant Escherichia coli CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Escherichia coli (strain K12) Uniprot NO.:P0ABF8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQSTR FGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSSV AVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSmLQYLSAARADLLD Q Protein Names:Recommended name: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5 Alternative name(s): Phosphatidylglycerophosphate synthase Short name= PGP synthase Gene Names:Name:pgsA Ordered Locus Names:b1912, JW1897 Expression Region:2-182 Sequence Info:fµLl length protein