ELISA Recombinant Aethia pusilla NADH-ubiquinone oxidoreductase chain 6(MT-ND6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Aethia pusilla (Least auklet) Uniprot NO.:P43190 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTYFVLFLGLCFVLGGLAVASKPSPYYGVVGLVLASVAGCGWLLSLGVSFVSLVLFMVYL GGmLVVFVYSVSLAADPFPEAWGDLGVVGYGVGFVMVLMVGMVVGGFVGSLDFGVVTVDS VGMFSVRLDFSGVAMFYSCGVGMFLVAGWGLLLTLFVVLELVRGLSRGAIRAV Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 6 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 6 Gene Names:Name:MT-ND6 Synonyms:MTND6, NADH6, ND6 Expression Region:1-173 Sequence Info:fµLl length protein