Skip to Content

ELISA Recombinant Octopus vulgaris Gonadotropin-releasing hormone receptor(GNRHR)

https://assay.labm.com/web/image/product.template/148056/image_1920?unique=90f0e4f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Octopus vµLgaris (Common octopus) Uniprot NO.:Q2V2K5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDYLNDSMFNNMTYNITSTPLPDAPRFDNVYVSKLCVLGTVFVISFFGNTLVIIQIFRIR GSRSTIQSLILNLAIADLMVSFFNILMDIIWSATVEWLAGNTMCKIMKYLTVFGLHLSTY ITVSIALDRCFAILSPMSRSKAPLRVRIMITMAWVLSAIFSIPQAVIFQEQRKMFRQGMF HQCRDSYNALWQKQLYSASSLILLFVIPLIIMVTSYLLILKTIVKTSRQFHDTPISPTSM SCYSVNHGQIRTHLFERARKRSSRMSAVIVAAFILCWTPYYIIFLGFAFFQWDNSRTVIY FFTLGTSNCmLNPLIYGAFTIYKVHRGRSGSANSPSGTRLMIMVNKRGRSTTTTTNRMSG SGRRQLTTGQTITQCASLTNPHQPVRPSPGINSTTSPNGKMPTKPPG Protein Names:Recommended name: Gonadotropin-releasing hormone receptor Short name= GnRH receptor Short name= GnRH-R Short name= oct-GnRHR Gene Names:Name:GNRHR Expression Region:1-407 Sequence Info:fµLl length protein

1,765.00 € 1765.0 EUR 1,765.00 € Tax Excluded

1,765.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF009637OAH-GB
Website URL: /shop/csb-cf009637oah-gb-elisa-recombinant-octopus-vulgaris-gonadotropin-releasing-hormone-receptor-gnrhr-148056

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.