ELISA Recombinant Callicebus moloch Dolichyldiphosphatase 1(DOLPP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Callicebus moloch (Dusky titi monkey) Uniprot NO.:B1MTH4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLGPVFVIVGFVTLIIFKRELHTI SFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYL RMHQTNNARFLDLLWRHVLSLGLLAAAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAVAWF IFTQEVLTPLFPRIAAWPISEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ Protein Names:Recommended name: Dolichyldiphosphatase 1 EC= 3.6.1.43 Alternative name(s): Dolichyl pyrophosphate phosphatase 1 Gene Names:Name:DOLPP1 Expression Region:1-238 Sequence Info:fµLl length protein