Skip to Content

ELISA Recombinant Aspergillus clavatus NADH-cytochrome b5 reductase 1(cbr1)

https://assay.labm.com/web/image/product.template/117701/image_1920?unique=7f7b80c
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) Uniprot NO.:A1C7E9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSALSSENVNGVYIPSALLVFGTFLVKKEFVPYAVALTAVLAGFKLFTGDSKARKVLNPT EFQEFVLKEKTDISHNVSIYRFALPRPTDILGLPIGQHISLAATIEGQPKEVVRSYTPIS SDNEAGYFDLLVKAYPQGNISKHLTTLKVGDVMKVRGPKGAMVYTPNMCRHIGMIAGGTG ITPmLQVIKAIIRNRPRNGGTDITKVDLIFANVNPEDILLKEELDKLAAEDEDFNIYYVL NNPPQGWTGGVGFVTPEMIKERLPAPASDVKVLLCGPPPMISAMKKATESLGFTKARPVS KLEDQVFCF Protein Names:Recommended name: NADH-cytochrome b5 reductase 1 EC= 1.6.2.2 Alternative name(s): Microsomal cytochrome b reductase Gene Names:Name:cbr1 ORF Names:ACLA_073550 Expression Region:1-309 Sequence Info:fµLl length protein

1,661.00 € 1661.0 EUR 1,661.00 € Tax Excluded

1,661.00 € Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.


Hieff NGS

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF006318AVC
Website URL: /shop/csb-cf006318avc-elisa-recombinant-aspergillus-clavatus-nadh-cytochrome-b5-reductase-1-cbr1-117701

Our Products !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.