ELISA Recombinant Hirudo nipponia Guamerin

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: others Target / Protein: Biologically active: Not Tested Expression system: Yeast Species of origin: Hirudo nipponia (Korean blood-sucking leech) Delivery time: 3-7 business days Uniprot ID: P46443 AA Sequence: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA Tag info: N-terminal 6xHis-tagged Expression Region: 1-57aa Protein length: FµLl Length MW: 8.1 kDa Alternative Name(s): Relevance: Inhibits mammalian elastases. Reference: "Isolation and characterization of guamerin, a new leukocyte elastase inhibitor from Hirudo nipponia."Jung H.I., Kim S.I., Ha K.-S., Joe C.O., Kang K.W.J. Biol. Chem. 270:13879-13884(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.