ELISA Recombinant Ustilago maydis P6 virus KP6 killer toxin

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Others Uniprot ID: P16948 Gene Names: N/A Organism: Ustilago maydis P6 virus (UmV6) (UmV-P6) AA Sequence: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS Expression Region: 28-105aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 10.6 kDa Alternative Name(s): Relevance: This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellµLar receptors before interaction of the complex with KP6 beta, precipitating cell death. Reference: Structure of Ustilago maydis killer toxin KP6 alpha-subunit. A mµLtimeric assembly with a central pore.Li N., Erman M., Pangborn W., Duax W.L., Park C.M., Bruenn J., Ghosh D.J. Biol. Chem. 274:20425-20431(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.