ELISA Recombinant Proteoglycan 4(PRG4),partial

Quantity:20µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Signal Transduction Uniprot ID:Q92954 Gene Names:Prg4 Organism:Homo sapiens () AA Sequence:QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE Expression Region:25-156aa Sequence Info:Partial Source:Yeast Tag Info:N-terminal 6xHis-tagged MW:16.8 Alternative Name(s):Lubricin (Megakaryocyte-stimµLating factor) (Superficial zone proteoglycan) (MSF) (SZP) Relevance:Plays a role in boundary lubrication within articµLating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface. Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages. Reference:"Purification, biochemical characterization, and cloning of a novel megakaryocyte stimµLating factor that has megakaryocyte colony stimµLating activity." Turner K.J., Fitz L.J., Temple P., Jacobs K., Larson D., Leary A.C., Kelleher K., Giannotti J., Calvetti J., Fitzgerald M., Kriz M.-J., Ferenz C., Grobholz J., Fraser H., Bean K., Norton C.R., Gesner T., Bhatia S. Clark S.C. Blood 78:279A-279A(1991) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days