ELISA Recombinant Bacillus subtilis Expansin-yoaJ(yoaJ)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O34918
Gene Names: yoaJ
Organism: Bacillus subtilis (strain 168)
AA Sequence: AYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE
Expression Region: 26-232aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 38.9 kDa
Alternative Name(s): EXLX1
Relevance: May promote colonization of plant roots. May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellµLose microfibrils and matrix glucans. Has very low expansin activity (in vitro). No enzymatic activity has been found. Binds to peptidoglycan and to plant cell walls.
Reference: Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization.Kerff F., Amoroso A., Herman R., Sauvage E., Petrella S., Filee P., Charlier P., Joris B., Tabuchi A., Nikolaidis N., Cosgrove D.J.Proc. Natl. Acad. Sci. U.S.A. 105:16876-16881(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Référence interne:
CSB-EP522026BRJ
URL de site web:
/shop/csb-ep522026brj-elisa-recombinant-bacillus-subtilis-expansin-yoaj-yoaj-118842
Your Dynamic Snippet will be displayed here...
This message is displayed because youy did not provide both a filter and a template to use.
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.