ELISA Recombinant Glycine max 2S albumin(GM2S-1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P19594 Gene Names: GM2S-1 Organism: Glycine max (Soybean) (Glycine hispida) AA Sequence: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD Expression Region: 22-158aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 32.2 kDa Alternative Name(s): Relevance: This is a 2S seed storage protein. Reference: A soybean cDNA encoding a chromatin-binding peptide inhibits mitosis of mammalian cells.Galvez A.F., de Lumen B.O.Nat. Biotechnol. 17:495-500(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.