ELISA Recombinant Conus vexillum Alpha-conotoxin VxXXC

Quantity: 200µg. 
Other Quantitys are also available. Please Inquire. 
Lead time: 10-20 working days
Uniprot ID: P0C1W7  
Gene Names: N/A 
Organism: Conus vexillum (Flag cone) 
AA Sequence: DLRQCTRNAPGSTWGRCCLNPMCGNFCCPRSGCTCAYNWRRGIYCSC 
Expression Region: 1-47aa 
Sequence Info: FµLl Length S
ource: E.coli 
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged 
MW: 25.3 kDa 
Alternative Name(s): VxXIIC 
Relevance: Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. 
This toxin specifically blocks mammalian neuronal nAChR of the alpha-7/CHRNA7, alpha-3-beta-2/CHRNA3-CHRNB2 and alpha-4-beta-2/CHRNA4-CHRNB2 subtypes. VxXXA and VxXXB inhibit alpha-7/CHRNA7 and alpha-3-beta-2/CHRNA3-CHRNB2 nAChR more efficiently than VxXXC. VxXXB is the most effective at inhibiting alpha-4-beta-2/CHRNA4-CHRNB2 nAChR, followed by VxXXC and VxXXA. Reference: "Identification of a novel class of nicotinic receptor antagonists: dimeric conotoxins VxXIIA, VxXIIB and VxXIIC from Conus vexillum." Loµghnan M., Nicke A., Jones A., Schroeder C.I., Nevin S.T., Adams D.J., Alewood P.F., Lewis R.J. J. Biol. Chem. 281:24745-24755(2006) Purity: Greater than 85% as determined by SDS-PAGE. 
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.